Overview

  • Product name

    Anti-Laminin beta 1 antibody
    See all Laminin beta 1 primary antibodies
  • Description

    Rabbit polyclonal to Laminin beta 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Laminin beta 1 aa 920-970 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEV G


    Database link: P07942

  • Positive control

    • Rat kidney and instestine tissues; Human oral squamous cell carcinoma and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Sequence similarities

    Contains 13 laminin EGF-like domains.
    Contains 1 laminin IV type B domain.
    Contains 1 laminin N-terminal domain.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domains VI and IV are globular.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLM antibody
    • Cutis laxa with marfanoid phenotype antibody
    • LAM B1 antibody
    • LAMB 1 antibody
    • LAMB1 antibody
    • LAMB1_HUMAN antibody
    • Laminin B1 antibody
    • Laminin B1 chain antibody
    • Laminin beta 1 chain antibody
    • Laminin beta 1 chain precursor antibody
    • Laminin beta1 antibody
    • Laminin subunit beta 1 antibody
    • Laminin subunit beta-1 antibody
    • Laminin-1 subunit beta antibody
    • Laminin-10 subunit beta antibody
    • Laminin-12 subunit beta antibody
    • Laminin-2 subunit beta antibody
    • Laminin-6 subunit beta antibody
    • Laminin-8 subunit beta antibody
    • LIS5 antibody
    • MGC142015 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat kidney tissue, labeling Laminin beta 1 using ab216830 at a 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human oral squamous cell carcinoma tissue, labeling Laminin beta 1 using ab216830 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat intestine tissue, labeling Laminin beta 1 using ab216830 at a 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue, labeling Laminin beta 1 using ab216830 at a 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up