Overview

  • Product name

  • Description

    Rabbit polyclonal to LAMP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human LAMP2 aa 305-355 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    LVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQP F


    Database link: P13473

  • Positive control

    • IHC-P: Mouse lung tissue. WB: Mouse intestine, liver and placenta lysates. Flow Cyt: U937 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab203224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 45 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 – 1/200 using a fluorescent secondary antibody).

Flow Cyt 1/20 - 1/100.

Target

  • Function

    Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter-and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens.
  • Tissue specificity

    Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver.
  • Involvement in disease

    Defects in LAMP2 are the cause of Danon disease (DAND) [MIM:300257]; also known as glycogen storage disease type 2B (GSD2B). DAND is a lysosomal glycogen storage disease characterized by the clinical triad of cardiomyopathy, vacuolar myopathy and mental retardation. It is often associated with an accumulation of glycogen in muscle and lysosomes.
  • Sequence similarities

    Belongs to the LAMP family.
  • Post-translational
    modifications

    O- and N-glycosylated; some of the 16 N-linked glycans are polylactosaminoglycans.
  • Cellular localization

    Cell membrane. Endosome membrane. Lysosome membrane. This protein shuttles between lysosomes, endosomes, and the plasma membrane.
  • Information by UniProt
  • Database links

  • Form

    Alternative splicing produces 3 isoforms.
  • Alternative names

    • CD107 antigen like family member B antibody
    • CD107 antigen-like family member B antibody
    • CD107b antibody
    • LAMP 2 antibody
    • LAMP 2C antibody
    • LAMP-2 antibody
    • LAMP2 antibody
    • LAMP2_HUMAN antibody
    • LAMPB antibody
    • LGP 96 antibody
    • LGP110 antibody
    • LGP96 antibody
    • Lysosomal associated membrane protein 2 antibody
    • Lysosome associated membrane glycoprotein 2 antibody
    • Lysosome associated membrane protein 2 antibody
    • Lysosome-associated membrane glycoprotein 2 antibody
    • Lysosome-associated membrane protein 2 antibody
    • MAC3 antibody
    see all

Images

  • All lanes : Anti-LAMP2 antibody (ab203224) at 1/200 dilution

    Lane 1 : Mouse intestine lysate
    Lane 2 : Mouse liver lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 45 kDa

  • Flow cytometric analysis of U937 (human histiocytic lymphoma cell line) cells labeling LAMP2 withab203224 at 1/100 dilution for 30 minutes followed by incubation with a PE Conjugated secondary (green) for 30 minutes, compared to control cells (blue), secondary only (light blue) and isotype control (orange).

  • Anti-LAMP2 antibody (ab203224) at 1/100 dilution + Mouse placenta lysate

    Predicted band size: 45 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded mouse lung tissue labelling LAMP2 with ab203224 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Chen H  et al. Effect of autophagy on allodynia, hyperalgesia and astrocyte activation in a rat model of neuropathic pain. Int J Mol Med 42:2009-2019 (2018). Read more (PubMed: 30015858) »
  • Zhang LX  et al. Niclosamide attenuates inflammatory cytokines via the autophagy pathway leading to improved outcomes in renal ischemia/reperfusion injury. Mol Med Rep 16:1810-1816 (2017). Read more (PubMed: 28627643) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up