Overview

  • Product name

  • Description

    Rabbit polyclonal to LAMTOR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human LAMTOR1 aa 1-161.
    Sequence:

    MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDE QALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLH WKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAK EELVVQFGIP


    Database link: Q6IAA8

  • Positive control

    • WB: HeLa and SK-N-SH whole cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab229760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 18 kDa.

Target

  • Function

    Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids. Directly responsible for anchoring the Ragulator complex to membranes. Also required for late endosomes/lysosomes biogenesis it may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes. May be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes. May also play a role in RHOA activation.
  • Sequence similarities

    Belongs to the LAMTOR1 family.
  • Cellular localization

    Late endosome membrane. Lysosome membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C11orf59 antibody
    • LAMTOR1 antibody
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 antibody
    • Lipid raft adaptor protein p18 antibody
    • LTOR1_HUMAN antibody
    • p18 antibody
    • p27Kip1-releasing factor from RhoA antibody
    • p27RF-Rho antibody
    • PDRO antibody
    • PP7157 antibody
    • Protein associated with DRMs and endosomes antibody
    • Ragulator complex protein LAMTOR1 antibody
    • ragulator complex protein PDRO antibody
    • Ragulator1 antibody
    • RhoA activator C11orf59 antibody
    see all

Images

  • All lanes : Anti-LAMTOR1 antibody (ab229760) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell extract
    Lane 2 : SK-N-SH (human neuroblastoma cell line) whole cell extract

    Lysates/proteins at 60 µg per lane.

    Secondary
    All lanes : HRP-conjugated anti-rabbit IgG

    Predicted band size: 18 kDa



    15% SDS-PAGE gel.

References

ab229760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up