Overview

  • Product name

  • Description

    Rabbit polyclonal to LAMTOR4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human LAMTOR4 aa 1-99.
    Sequence:

    MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA CGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV

  • Positive control

    • RT4 and U 251 MG cell lysates; Human small intestine tissue.
  • General notes

    Previously labelled as C7orf59. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

Images

  • Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
  • Immunofluorescent staining of Human cell line U-251MG shows positivity in golgi apparatus. Recommended concentration of ab121645 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • All lanes : Anti-LAMTOR4 antibody (ab121645) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U 251 MG cell lysate
    Lane 3 : Human Plasma lysate
    Lane 4 : Human Liver lysate
    Lane 5 : Human Tonsil lysate


    10-20% SDS PAGE
  • ab121645 at 1/10 dilution staining LAMTOR4 in Paraffin-embedded Human small intestine tissue by Immunohistochemistry.

References

ab121645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry free floating
Sample
Mouse Tissue sections (kidney)
Specification
kidney

Abcam user community

Verified customer

Submitted Nov 11 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up