Overview

  • Product name
  • Description
    Rabbit polyclonal to LANCL1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human LANCL1 aa 50-150.
    Sequence:

    GLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCL TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPN E


    Database link: O43813

  • Positive control
    • WB: Mouse heart, liver and stomach lysates. IHC-P: Human brain tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 45 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function
    May play a role in EPS8 signaling. Binds glutathion.
  • Tissue specificity
    Detected in erythrocytes, brain, kidney, testis, ovary, heart, lung, placenta and spleen (at protein level). Ubiquitous. Strongly expressed in brain, spinal cord, pituitary gland, kidney, heart, skeletal muscle, pancreas, ovary and testis.
  • Sequence similarities
    Belongs to the LanC-like protein family.
  • Cellular localization
    Cytoplasm. Membrane. Nucleus. Detected at the surface of Maurer's clefts in malaria-infected erythrocytes at late stages of parasite development.
  • Information by UniProt
  • Database links
  • Alternative names
    • 40 kDa erythrocyte membrane protein antibody
    • G protein-coupled receptor 69A antibody
    • GPR69A antibody
    • LanC (bacterial lantibiotic synthetase component C) like 1 antibody
    • LanC lantibiotic synthetase component C like 1 (bacterial) antibody
    • LanC-like protein 1 antibody
    • LANC1_HUMAN antibody
    • LANCL1 antibody
    • p40 antibody
    see all

Images

  • U251-MG (human brain glioma cell line) cells labeling LANCL1 (green) using ab234827 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-LANCL1 antibody (ab234827) at 1/500 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse stomach lysate

    Secondary
    All lanes : Goat anti-rabbit polyclonal igG at 1/50000 dilution

    Predicted band size: 45 kDa

  • Paraffin-embedded human brain tissue stained for LANCL1 using ab234827 at 1/100 dilution in immunohistochemical analysis.

References

ab234827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up