Anti-LANCL2 antibody (ab237520)
Key features and details
- Rabbit polyclonal to LANCL2
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LANCL2 antibody
See all LANCL2 primary antibodies -
Description
Rabbit polyclonal to LANCL2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human LANCL2 aa 2-106.
Sequence:GETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVR PPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCS AYTGW
Database link: Q9NS86 -
Positive control
- WB: A549 and U-87 MG whole cell lysate. IHC-P: Human brain tissue. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab237520 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Predicted molecular weight: 51 kDa. | |
IHC-P | 1/200 - 1/500. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes. -
Tissue specificity
Expressed in brain and testis. -
Sequence similarities
Belongs to the LanC-like protein family. -
Post-translational
modificationsMyristoylated. Essential for membrane association. -
Cellular localization
Nucleus. Cytoplasm. Cell membrane. Localizes to the juxta-nuclear vesicles. Associates with the cortical actin cytoskeleton. Cholesterol depletion by methyl-beta-cyclodextrin causes partial dissociation from the cell membrane in vitro and an enhanced cell detachment from the matrix in vivo. Membrane-association is important for the increased cellular sensitivity to an anticancer drug. - Information by UniProt
-
Database links
- Entrez Gene: 55915 Human
- SwissProt: Q9NS86 Human
- Unigene: 595384 Human
-
Alternative names
- G protein coupled receptor 69B antibody
- GPR69B antibody
- LanC (bacterial lantibiotic synthetase component C) like 2 antibody
see all
Images
-
All lanes : Anti-LANCL2 antibody (ab237520) at 1/500 dilution
Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 2 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 51 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LANCL2 antibody (ab237520)
Paraffin-embedded human brain tissue stained for LANCL2 using ab237520 at 1/300 dilution in immunohistochemical analysis.
After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for LANCL2 (Green) using ab237520 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab237520 has not yet been referenced specifically in any publications.