Overview

  • Product name

  • Description

    Rabbit polyclonal to LAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human LAP2 aa 1-454.
    Sequence:

    MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR PPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTD KPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLR EQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKRE PLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRES TRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTG NFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADV KSEKTKKGRSIPVWIKILLFVVVAVFLFLVYQAMETNQVNPFSNFLHVDP RKSN


    Database link: P42167

  • Positive control

    • Extracts from 22RV1, K562, HepG2, 293T, SH-SY5Y and H460 cell lines.

Properties

Applications

Our Abpromise guarantee covers the use of ab185718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 51 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Relevance

    Lamins are type V intermediate filament proteins and are grouped into constitutively expressed B-type lamins and developmentally regulated A-type lamins. Lamin-binding proteins in the nuclear lamina and the nuclear interior include several protein families and/or types of proteins in higher eukaryotes such as the inner nuclear membrane proteins, lamin B receptor, emerin, and MANI, three isoforms of lamina-associated polypeptide 1 (LAP1), and several isoforms of LAP2. Up to six LAP 2 isoforms derive from a single gene by alternative splicing in mammals and various isoforms have been described in Xenopus. The best characterized LAP2 isoforms are the inner nuclear membrane protein LAP2 beta and the nucleoplasmic protein LAP2 alpha, which are identical in their N-terminal 187-amino acid constant region but differ in their C termini. While LAP2 beta binds to B-type lamins at the nuclear periphery and was suggested to regulate nuclear lamina growth , LAP2 alpha specifically interacts with A-type lamins within the nuclear interior as part of a detergent/salt-resistant nucleoskeletal structure.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Lamina associated polypeptide 2 antibody
    • LAP 2 antibody
    • LEM domain containing 4 antibody
    • LEMD4 antibody
    • Thymopoietin antibody
    • Thymopoietin isoform alpha antibody
    • Thymopoietin related peptide isoform alpha antibody
    • Thymopoietin related peptide isoforms beta/gamma antibody
    • Thymopoietin, isoforms beta/gamma antibody
    • TMPO antibody
    • TP alpha antibody
    • TP antibody
    • TP beta/gamma antibody
    • TPRP isoform alpha antibody
    • TPRP isoforms beta/gamma antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse lung tissue labelling LAP2 with ab185718 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling LAP2 with ab185718 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human endometrial cancer tissue labelling LAP2 with ab185718 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling LAP2 with ab185718 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185718. Blue DAPI for nuclear staining.
  • All lanes : Anti-LAP2 antibody (ab185718) at 1/500 dilution

    Lane 1 : Extract from 22RV1 cell line.
    Lane 2 : Extract from K562 cell line.
    Lane 3 : Extract from HepG2 cell line.
    Lane 4 : Extract from 293T cell line.
    Lane 5 : Extract from SH-SY5Y cell line.
    Lane 6 : Extract from H460 cell line.

    Predicted band size: 51 kDa

References

ab185718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up