Overview

  • Product name

  • Description

    Rabbit polyclonal to LAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LAP2 aa 129-266.
    Sequence:

    VNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSN DSDRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQSYSQAGI TETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSE


    Database link: P42167

  • Positive control

    • IHC-P: Human stomach tissue. WB: RT4, U-251 MG, NIH/3T3 and NBT-II cell lysates. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 54 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Lamins are type V intermediate filament proteins and are grouped into constitutively expressed B-type lamins and developmentally regulated A-type lamins. Lamin-binding proteins in the nuclear lamina and the nuclear interior include several protein families and/or types of proteins in higher eukaryotes such as the inner nuclear membrane proteins, lamin B receptor, emerin, and MANI, three isoforms of lamina-associated polypeptide 1 (LAP1), and several isoforms of LAP2. Up to six LAP 2 isoforms derive from a single gene by alternative splicing in mammals and various isoforms have been described in Xenopus. The best characterized LAP2 isoforms are the inner nuclear membrane protein LAP2 beta and the nucleoplasmic protein LAP2 alpha, which are identical in their N-terminal 187-amino acid constant region but differ in their C termini. While LAP2 beta binds to B-type lamins at the nuclear periphery and was suggested to regulate nuclear lamina growth , LAP2 alpha specifically interacts with A-type lamins within the nuclear interior as part of a detergent/salt-resistant nucleoskeletal structure.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Lamina associated polypeptide 2 antibody
    • LAP 2 antibody
    • LEM domain containing 4 antibody
    • LEMD4 antibody
    • Thymopoietin antibody
    • Thymopoietin isoform alpha antibody
    • Thymopoietin related peptide isoform alpha antibody
    • Thymopoietin related peptide isoforms beta/gamma antibody
    • Thymopoietin, isoforms beta/gamma antibody
    • TMPO antibody
    • TP alpha antibody
    • TP antibody
    • TP beta/gamma antibody
    • TPRP isoform alpha antibody
    • TPRP isoforms beta/gamma antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for LAP2 using ab223768 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-LAP2 antibody (ab223768) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 54 kDa

  • All lanes : Anti-LAP2 antibody (ab223768) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 54 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for LAP2 (green) using ab223768 at 4 µg/ml in ICC/IF.

References

ab223768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up