Overview

  • Product name

  • Description

    Rabbit polyclonal to LAP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LAP3 aa 206-496. (Expressed in E.coli).
    Sequence:

    PANEMTPTRFAEVIEKNLKSASSKTEVHIRTKSWIEEQEMGSFLSVAKGS EEPPVFLEIHYTGSPNATEAPLVFVGKGITFDSGGISIKASANMDLMRAD MGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRARNG KTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDVALGSGAT GVFTNSSWLWNKLFEASVETGDRVWRMPLFEHYTRQVIDCQLADVNNLGK YRSAGACTAAAFLREFVTHTKWAHLDIAGVMTNKDEIPYLR


    Database link: Q68FS4

  • Positive control

    • IHC-P: Rat liver tissue. WB: Rat serum; Rat liver and kidney lysates; Recombinant rat LAP3 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 56 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for LAP3 using ab231553 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LAP3 antibody (ab231553) at 2 µg/ml + Recombinant rat LAP3 protein

    Predicted band size: 56 kDa

  • Anti-LAP3 antibody (ab231553) at 1 µg/ml + Rat kidney lysate

    Predicted band size: 56 kDa

  • Anti-LAP3 antibody (ab231553) at 1 µg/ml + Rat serum

    Predicted band size: 56 kDa

  • Anti-LAP3 antibody (ab231553) at 1 µg/ml + Rat liver lysate

    Predicted band size: 56 kDa

References

ab231553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up