Overview

  • Product name

  • Description

    Rabbit polyclonal to LARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human LARS2 aa 607-697.
    Sequence:

    PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQ YGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT


    Database link: Q15031

  • Positive control

    • IHC-P: Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • HLASA antibody
    • KIAA0028 antibody
    • LARS 2 antibody
    • Lars2 antibody
    • Leucine translase antibody
    • Leucine tRNA ligase 2 antibody
    • Leucine tRNA ligase 2 mitocondrial antibody
    • Leucine tRNA ligase antibody
    • Leucine--tRNA ligase antibody
    • Leucyl tRNA synthetase 2 antibody
    • Leucyl tRNA synthetase 2 mitochondrial antibody
    • LeuRS antibody
    • MGC26121 antibody
    • mtLeuRS antibody
    • PRLTS4 antibody
    • Probable leucyl-tRNA synthetase, mitochondrial antibody
    • SYLM_HUMAN antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for LARS2 using ab224502 at 1/20 dilution in immunohistochemical analysis.

References

ab224502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up