Overview

  • Product name

  • Description

    Rabbit polyclonal to LAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LAT2 aa 32-192. Expressed in E.coli. N-terminal tags.
    Sequence:

    RPGVKRNEKIYEQRNQQENEQSVASSQTYSLARPVRTGLQMDAASNKSFE RKNKLLFSHLEGPESPRYQNFYKGSRRESDAAYVDPIPTDYYNWGCFQKP PEDNDSNSYENVLICKPSTPESGTEESEDYQNSVSILQWRESKRTMGART SPSGSPDEEPD


    Database link: Q9WVR6

  • Positive control

    • IHC-P: Rat spleen tissue. WB: Rat spleen lysate; Recombinant rat LAT2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney.
  • Tissue specificity

    Strongest expression is observed in kidney and moderate expression in placenta and brain, followed by liver, prostate, testis, ovary, lymph node, thymus, spleen, skeletal muscle and heart. Also expressed in fetal liver as well as in the retinal pigment epithelial cell line ARPE-19 and the intestinal epithelial cell line Caco-2.
  • Sequence similarities

    Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
  • Cellular localization

    Cytoplasm. Basolateral cell membrane. Localized to the cytoplasm when expressed alone but when coexpressed with SLC3A2/4F2hc, is localized to the plasma membrane. Colocalized with SLC3A2/4F2hc at the basolateral membrane of kidney cortex proximal tubules and small intestine epithelia of the villi.
  • Information by UniProt
  • Database links

  • Alternative names

    • hLAT2 antibody
    • integral membrane protein E16H antibody
    • L type amino acid transporter 2 antibody
    • L-type amino acid transporter 2 antibody
    • Large neutral amino acids transporter small subunit 2 antibody
    • LAT2_HUMAN antibody
    • LPI PC1 antibody
    • SLC7A8 antibody
    • solute carrier family 7 (amino acid transporter light chain, L system), member 8 antibody
    • solute carrier family 7 (amino acid transporter, L type), member 8 antibody
    • solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 antibody
    • Solute carrier family 7 member 8 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat spleen tissue stained for LAT2 using ab233088 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LAT2 antibody (ab233088) at 2 µg/ml + Rat spleen lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG at 0.2 µg/ml

    Predicted band size: 58 kDa

  • Anti-LAT2 antibody (ab233088) at 2 µg/ml + Recombinant rat LAT2 protein

    Predicted band size: 58 kDa

References

ab233088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up