Overview

  • Product name

  • Description

    Rabbit polyclonal to LBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat LBP aa 27-481. N-terminal His and GST tags. Expressed in E. coli.
    Sequence:

    NPAMVVRITDKGLEYAAKEGLLSLQRELYKITLPDFSGDFKIKAVGRGQY EFHSLEIQSCQLRGSSLKPLPGRGLSLSISDSSISVRGKWKVRRSFVKLH GSFDLDVKSVTISVDLLLGVDPSERPTVTASGCSNRIRDLELHVSGNVGW LLNLFHNQIESKLQKVLESKICEMIQKSVTSDLQPYLQTLPVTADIDTIL GIDYSLVAAPQAKAQTLDVMFKGEIFNRNHRSPVTTPTPTMSLPEDSKQM VYFAISDQAFNIATRVYHQAGYLNFTITDDMLPPDSNIRLNTKAFRPFTP LITRKYPDMNLELLGTVVSAPLLNVSPGNLSLAPQMEIEGFVILPSSARE SVFRLGVVTNVFVSLTFDNSKVTGMLHPEKAQVRLIESKVGMFNVNLFQA FLNYYLLNSLYPDVNDELAKGFPLPLPRRIKLHDLDFQIHKNFLYLGANV QYMRV


    Database link: Q63313

  • Positive control

    • IHC-P: Rat kidney tissue. WB: Recombinant rat LBP protein. Rat liver tissue lysate. HepG2 whole cell lysate (ab7900).

Properties

Applications

Our Abpromise guarantee covers the use of ab231612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor.
  • Sequence similarities

    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BPI fold containing family D, member 2 antibody
    • Bpifd2 antibody
    • LBP antibody
    • LBP_HUMAN antibody
    • LBP1 antibody
    • Lipopolysaccharide binding protein antibody
    • Lipopolysaccharide-binding protein antibody
    • LPS binding protein antibody
    • Ly88 antibody
    • MGC22233 antibody
    • OTTHUMP00000030965 antibody
    • RP23-407H16.4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for LBP with ab231612 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-LBP antibody (ab231612) at 1 µg/ml

    Lane 1 : Rat liver tissue lysate
    Lane 2 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-LBP antibody (ab231612) at 2 µg/ml + Recombinant rat LBP protein

References

ab231612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up