Overview

  • Product name

  • Description

    Rabbit polyclonal to LBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse LBP aa 25-481. Two N-terminal tags, expressed in E.coli.
    Sequence:

    GVNPGVVARITDKGLAYAAKEGLVALQRELYKITLPDFSGDFKIKAVGRG QYEFHSLEIQNCELRGSSLKLLPGQGLSLAISDSSIGVRGKWKVRKSFLK LHGSFDLDVKGVTISVDLLLGMDPSGRPTVSASGCSSRICDLDVHISGNV GWLLNLFHNQIESKLQKVLENKVCEMIQKSVTSDLQPYLQTLPVTAEIDN VLGIDYSLVAAPQAKAQVLDVMFKGEIFNRNHRSPVATPTPTMSLPEDSK QMVYFAISDYAFNIASRVYHQAGYLNFSITDDMLPHDSGIRLNTKAFRPF TPQIYKKYPDMKLELLGTVVSAPILNVSPGNLSLAPQMEIEGFVILPTSA REPVFRLGVVTNVFASLTFNNSKVTGMLHPDKAQVRLIESKVGMFNVNLF QAFLNYYLLNSLYPDVNAELAQGFPLPLPRHIQLHDLDFQIRKDFLYLGA NVQYMRV


    Database link: Q61805

  • Positive control

    • WB: Recombinant mouse LBP; A431 cell lysate; Rat liver and pancreas tissue lysate. IHC-P: Mouse testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 53 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formallin-fixed, paraffin-embedded mouse testis tissue stained for LBP using ab233524 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LBP antibody (ab233524) at 2 µg/ml + Recombinant mouse LBP

    Developed using the ECL technique.

    Predicted band size: 53 kDa

  • Anti-LBP antibody (ab233524) at 2 µg/ml + A431 (human epidermoid carcinoma cell line) whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

  • Anti-LBP antibody (ab233524) at 2 µg/ml + Rat liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

  • Anti-LBP antibody (ab233524) at 2 µg/ml + Rat pancreas tissue lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

References

ab233524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up