Overview

  • Product name
    Anti-LBX1 antibody
  • Description
    Rabbit polyclonal to LBX1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Xenopus laevis
  • Immunogen

    Synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (

    PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT

    ) (NP_006553)

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Western blot analysis of OVCAR-3 cell lysate labeling LBX1 with ab90839 at 1.0µg/ml.
  • Anti-LBX1 antibody (ab90839) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa

  • Western blot analysis of Human fetal lung tissue lysate labeling LBX1 with ab90839 at 1.0µg/ml.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up