Overview

  • Product name

  • Description

    Rabbit polyclonal to LCN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat LCN1 aa 22-173. (Expressed in E.coli).
    Sequence:

    PTTEENQDVSGTWYLKAAAWDKEIPDKKFGSVSVTPMKIKTLEGGNLQVK FTVLIAGRCKEMSTVLEKTDEPAKYTAYSGKQVLYIIPSSVEDHYIFYYE GKIHRHHFQIAKLVGRDPEINQEALEDFQSVVRAGGLNPDNIFIPKQSET CP


    Database link: P20289

  • Positive control

    • WB: Human saliva; Rat serum; Recombinant rat LCN1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231104 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
  • Tissue specificity

    Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • LCN1 antibody
    • LCN1_HUMAN antibody
    • Lipocalin 1 (protein migrating faster than albumin, tear prealbumin) antibody
    • Lipocalin 1 like 2 antibody
    • Lipocalin-1 antibody
    • PMFA antibody
    • Tear lipocalin antibody
    • Tear prealbumin antibody
    • Tlc antibody
    • TP antibody
    • VEG protein antibody
    • VEGP antibody
    • Von Ebner gland protein antibody
    see all

Images

  • Anti-LCN1 antibody (ab231104) at 2 µg/ml + Rat serum

    Predicted band size: 20 kDa

  • Anti-LCN1 antibody (ab231104) at 2 µg/ml + Human saliva

    Predicted band size: 20 kDa

  • Anti-LCN1 antibody (ab231104) at 2 µg/ml + Recombinant rat LCN1 protein

    Predicted band size: 20 kDa

References

ab231104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up