Overview

  • Product name

  • Description

    Rabbit polyclonal to LCN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human LCN1 aa 107-156 (internal sequence).
    Sequence:

    IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Properties

Applications

Our Abpromise guarantee covers the use of ab87786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
  • Tissue specificity

    Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • LCN1 antibody
    • LCN1_HUMAN antibody
    • Lipocalin 1 (protein migrating faster than albumin, tear prealbumin) antibody
    • Lipocalin 1 like 2 antibody
    • Lipocalin-1 antibody
    • PMFA antibody
    • Tear lipocalin antibody
    • Tear prealbumin antibody
    • Tlc antibody
    • TP antibody
    • VEG protein antibody
    • VEGP antibody
    • Von Ebner gland protein antibody
    see all

Images

  • Anti-LCN1 antibody (ab87786) at 1 µg/ml + HepG2 Cell Lysate

References

This product has been referenced in:

  • Wang JC  et al. A bead-based fluorescence immunosensing technique enabled by the integration of Förster resonance energy transfer and optoelectrokinetic concentration. Biomicrofluidics 10:014113 (2016). Read more (PubMed: 26865906) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up