Overview

  • Product name

  • Description

    Rabbit polyclonal to LCN12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse LCN12 aa 30-193. (N-terminal His-tag and GST-tag. Expressed in E.coli).
    Sequence:

    MRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHK TYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQID KYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPR GSTAIGMKETAAAKFERQHMDSPDLGTLEVLFQGPLGSEFQMTSFQSDQF QGEWFVLGLADNTFRREHRALLNFFTTLFELKEKSQFQVTNSMTRGKHCN TWSYTLIPATKPGQFTRDNRGSGPGADRENIQVIETDYITFALVLSLRQT SSQNITRVSLLGRNWRLSHKTIDKFICLTRTQNLTKDNFLFPDLSDWLPD PQVC


    Database link: Q6JVL5

  • Positive control

    • IHC-P: Mouse testis tissue. WB: Mouse testis lysate; Recombinant mouse LCN12 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds all-trans retinoic acid and may act as a retinoid carrier protein within the epididymis. May play a role in male fertility.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epididymal-specific lipocalin-12 antibody
    • LCN12 antibody
    • LCN12_HUMAN antibody
    • Lipocalcin 12 antibody
    • Lipocalin 12 antibody
    • MGC34753 antibody
    • MGC48935 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for LCN12 using ab231127 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LCN12 antibody (ab231127) at 2 µg/ml + Recombinant mouse LCN12 protein

    Predicted band size: 22 kDa

  • Anti-LCN12 antibody (ab231127) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 22 kDa

References

ab231127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up