Overview

  • Product name

  • Description

    Rabbit polyclonal to LCN12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human LCN12 aa 61-184. (N-terminal His-tag and GST-tag. Expressed in E.coli).
    Sequence:

    LNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGV EPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLGRSWLLPPGTL DQFICLGRAQGLSDDNIVFPDVTG


    Database link: Q6JVE5

  • Positive control

    • WB: Recombinant human LCN12 protein; Mouse testis lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.

Target

Images

  • Anti-LCN12 antibody (ab231146) at 2 µg/ml + Recombinant human LCN12 protein

    Predicted band size: 22 kDa

  • Anti-LCN12 antibody (ab231146) at 3 µg/ml + Mouse testis lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 22 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for LCN12 with ab231146 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up