Overview

  • Product name

    Anti-LCN6 antibody
  • Description

    Rabbit polyclonal to LCN6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LCN6 aa 21-163.
    Sequence:

    VWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLR TLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAII FTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ


    Database link: P62502

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    LCN6 is a member of the lipocalin family of hydrophobic ligand binding proteins and exhibit conserved beta strand basket like structures. LCN6 may play a role in male fertility.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Epididymal specific lipocalin 6 antibody
    • Epididymal specific lipocalin ELP16 antibody
    • Epididymal specific lipocalin LCN6 antibody
    • hLcn5 antibody
    • LCN5 antibody
    • Lipocalin 5 antibody
    • Lipocalin 6 antibody
    • MCG18768 antibody
    • UNQ643 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for LCN6 using ab229771 at 1/100 dilution in immunohistochemical analysis.

References

ab229771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up