Anti-LCN8 antibody (ab233510)
Key features and details
- Rabbit polyclonal to LCN8
- Suitable for: IHC-P, WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-LCN8 antibody -
Description
Rabbit polyclonal to LCN8 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse LCN8 aa 27-175. (Expressed in E.coli).
Sequence:LVPEKIAGFWKEVAVASDQKLVLKAQRRVEGLFLTFSGGNVTVKAVYNSS GSCVTESSLGSERDTVGEFAFPGNREIHVLDTDYERYTILKLTLLWQGRN FHVLKYFTRSLENEDEPGFWLFREMTADQGLYMLARHGRCAELLKEGLV
Database link: Q924P3 -
Positive control
- IHC-P: Mouse kidney, vas deferens, ovary and uterus tissues. WB: Mouse testis lysate; Recombinant mouse LCN8 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab233510 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Isotype control
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233510 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Function
May play a role in male fertility. May act as a retinoid carrier protein within the epididymis. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 78076 Mouse
- SwissProt: Q924P3 Mouse
- Unigene: 196708 Mouse
-
Alternative names
- Epididymal specific lipocalin 8 antibody
- Epididymal-specific lipocalin-8 antibody
- LCN5 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LCN8 antibody (ab233510)
Paraffin-embedded mouse kidney tissue stained for LCN8 using ab233510 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LCN8 antibody (ab233510)Paraffin-embedded mouse vas deferens tissue stained for LCN8 using ab233510 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LCN8 antibody (ab233510)Paraffin-embedded mouse ovary tissue stained for LCN8 using ab233510 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LCN8 antibody (ab233510)Paraffin-embedded mouse uterus tissue stained for LCN8 using ab233510 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-LCN8 antibody (ab233510)Anti-LCN8 antibody (ab233510) at 3 µg/ml + Recombinant mouse LCN8 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 20 kDa -
Western blot - Anti-LCN8 antibody (ab233510)Anti-LCN8 antibody (ab233510) at 3 µg/ml + Mouse testis lysate
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 20 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233510 has not yet been referenced specifically in any publications.
