Overview

  • Product name

  • Description

    Rabbit polyclonal to LCOR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human LCOR aa 6-80.
    Sequence:

    QQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK LLMADQDSPLDLTVRKSQSEPSEQD


    Database link: Q96JN0

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3' (By similarity). Repressor of ligand-dependent transcription activation by target nuclear receptors. Repressor of ligand-dependent transcription activation by ESR1, ESR2, NR3C1, PGR, RARA, RARB, RARG, RXRA and VDR.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 HTH psq-type DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • A630025C20RIK antibody
    • C10orf12 antibody
    • FLJ38026 antibody
    • KIAA1795 antibody
    • LCoR antibody
    • LCOR_HUMAN antibody
    • Ligand dependent corepressor antibody
    • Ligand dependent nuclear receptor corepressor antibody
    • Ligand-dependent corepressor antibody
    • Mblk1 related protein 2 antibody
    • Mblk1-related protein 2 antibody
    • MLR2 antibody
    • RP11 175O19.1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for LCOR (green) using ab223167 at 4 µg/ml in ICC/IF.

References

ab223167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up