Overview

  • Product name

    Anti-LCT antibody
  • Description

    Rabbit polyclonal to LCT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LCT aa 983-1252.
    Sequence:

    IFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLFHWDLPQALQDIGG WENPALIDLFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFPPG VKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPK SPGVPRDVEAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLA TSRLPSFTEEEKRFIRATADVFCLNTYYSRIVQHKTPRLNPPSYEDDQEM AEEEDPSWPSTAMNRAAPWG


    Database link: P09848

  • Positive control

    • IHC-P: Human lung cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab238593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    LPH splits lactose in the small intestine.
  • Tissue specificity

    Intestine.
  • Involvement in disease

    Defects in LCT are the cause of congenital lactase deficiency (COLACD) [MIM:223000]; also known as hereditary alactasia or disaccharide intolerance II. Congenital lactase deficiency is a an autosomal recessive, rare and severe gastrointestinal disorder. It is characterized by watery diarrhea in infants fed with breast milk or other lactose-containing formulas. An almost total lack of LCT activity is found in jejunal biopsy material of patients with congenital lactase deficiency. Opposite to congenital lactase deficiency, adult-type hypolactasia, also known as lactose intolerance, is the most common enzyme deficiency worldwide. It is caused by developmental down-regulation of lactase activity during childhood or early adulthood. The decline of lactase activity is a normal physiological phenomenon; however, the majority of Northern Europeans have the ability to maintain lactase activity and digest lactose throughout life (lactase persistence). The down-regulation of lactase activity operates at the transcriptional level and it is associated with a noncoding variation in the MCM6 gene, located in the upstream vicinity of LCT.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 1 family.
  • Domain

    The sequence exhibits 4 regions (I-IV) of internal homology; therefore LPH might have evolved by two cycles of partial gene duplication.
  • Cellular localization

    Apical cell membrane. Brush border.
  • Information by UniProt
  • Database links

  • Alternative names

    • LAC antibody
    • Lactase antibody
    • Lactase phlorizin hydrolase 1 antibody
    • Lactase phlorizin hydrolase antibody
    • Lactase-glycosylceramidase antibody
    • Lct antibody
    • LPH antibody
    • LPH_HUMAN antibody
    • LPH1 antibody
    • Phlorizin hydrolase antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for LCT using ab238593 at 1/100 dilution in immunohistochemical analysis.

References

ab238593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up