Overview

  • Product name

  • Description

    Rabbit polyclonal to LDB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Chicken
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human LDB1 aa 112-411. (Expressed in E.coli).
    Sequence:

    DGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQ GSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRS ILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKT YSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRKMSGGSTMSSGG GNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRL ENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ


    Database link: Q86U70

  • Positive control

    • WB: Jurkat cell lysate; Pig kidney lysate; Recombinant human LDB1 protein. IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.

Target

  • Function

    Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. May play a role in the development of motor neurons. Acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. Acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state.
  • Tissue specificity

    Expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the LDB family.
  • Domain

    The dimerization domain is located in the N-terminus.
  • Post-translational
    modifications

    Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxyl Terminal LIM Domain Binding 2 antibody
    • Carboxyl-terminal LIM domain-binding protein 2 antibody
    • CLIM 2 antibody
    • CLIM-2 antibody
    • hLdb1 antibody
    • LDB-1 antibody
    • ldb1 antibody
    • LDB1_HUMAN antibody
    • LIM Domain Binding 1 antibody
    • LIM domain binding factor CLIM2 antibody
    • LIM domain-binding factor CLIM2 antibody
    • LIM domain-binding protein 1 antibody
    • NLI antibody
    • Nuclear LIM Domain Interactor antibody
    • Nuclear LIM interactor antibody
    • xldb1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for LDB1 using ab233213 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-LDB1 antibody (ab233213) at 1 µg/ml

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 2 : Pig kidney tissue

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 47 kDa

  • Anti-LDB1 antibody (ab233213) at 2 µg/ml + Recombinant human LDB1 protein

    Predicted band size: 47 kDa

References

ab233213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up