Overview

  • Product name
  • Description
    Rabbit polyclonal to LDH-C
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein corresponding to Human LDH-C aa 2-332.
    Sequence:

    STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALV DVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQ EGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKIS GLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLW SGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWA IGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVS DVVKINLNSEEEALFKKSAETLWNIQKDLIF


    Database link: P07864

  • Positive control
    • WB: NIH/3T3 and HepG2 whole cell lysates; Mouse brain, heart, lung and thymus tissue lysates; Rat liver tissue lysate. IHC-P: Human small intestine and testis tissues. ICC/IF: HeLa cells.
  • General notes

    Previously labelled as Lactate Dehydrogenase C. 

Properties

Applications

Our Abpromise guarantee covers the use of ab222910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 37 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human small intestine tissue stained for Lactate Dehydrogenase C / LDH-C using ab222910 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-LDH-C antibody (ab222910) at 1/500 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Mouse brain tissue lysate
    Lane 4 : Mouse heart tissue lysate
    Lane 5 : Mouse lung tissue lysate
    Lane 6 : Mouse thymus tissue lysate
    Lane 7 : Rat liver tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG

    Predicted band size: 37 kDa
    Observed band size: 37 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Lactate Dehydrogenase C / LDH-C (green) using ab222910 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for Lactate Dehydrogenase C / LDH-C using ab222910 at 1/100 dilution in immunohistochemical analysis.

References

ab222910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up