Name: Anti-LDH-C antibody
SKU: ab222910

Product name

Anti-LDH-C antibody
See all LDH-C primary antibodies
Description

Rabbit polyclonal to LDH-C
Host species

Rabbit
Tested applications

Suitable for: ICC/IF, WB, IHC-Pmore details
Species reactivity

Reacts with: Mouse, Rat, Human
Predicted to work with: Pig
Immunogen

Recombinant full length protein corresponding to Human LDH-C aa 2-332.
Sequence:
STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALV DVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQ EGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKIS GLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLW SGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWA IGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVS DVVKINLNSEEEALFKKSAETLWNIQKDLIF

Database link: P07864

Run BLAST with Run BLAST with
Positive control
- WB: NIH/3T3 and HepG2 whole cell lysates; Mouse brain, heart, lung and thymus tissue lysates; Rat liver tissue lysate. IHC-P: Human small intestine and testis tissues. ICC/IF: HeLa cells.
General notes

Previously labelled as Lactate Dehydrogenase C.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS
Concentration information loading...
Purity

Protein G purified
Purification notes

Purity >95%
Clonality

Polyclonal
Isotype

IgG
Research areas

Our Abpromise guarantee covers the use of ab222910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
ICC/IF		1/50 - 1/200.
WB		1/500 - 1/5000. Predicted molecular weight: 37 kDa.
IHC-P		1/20 - 1/200.

Function

Possible role in sperm motility.
Pathway

Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
Sequence similarities

Belongs to the LDH/MDH superfamily. LDH family.
Cellular localization

Cytoplasm.
Target information above from: UniProt accession P07864 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 3948 Human
- Entrez Gene: 16833 Mouse
- Entrez Gene: 100502559 Pig
- Entrez Gene: 29634 Rat
- Omim: 150150 Human
- SwissProt: P07864 Human
- SwissProt: P00342 Mouse
- SwissProt: Q9TSX5 Pig
- SwissProt: P19629 Rat
- Unigene: 654377 Human
- Unigene: 16563 Mouse
- Unigene: 9984 Rat
see all
Alternative names
- Cancer/testis antigen 32 antibody
- CT32 antibody
- EC 1.1.1.27 antibody
- L lactate dehydrogenase C chain antibody
- L-lactate dehydrogenase C chain antibody
- Lactate Dehydrogenase C antibody
- Lactate dehydrogenase c variant 1 antibody
- Lactate dehydrogenase c variant 3 antibody
- Lactate dehydrogenase c variant 4 antibody
- Lactate dehydrogenase C4 antibody
- LDH C antibody
- LDH testis subunit antibody
- LDH X antibody
- LDH-C antibody
- LDH-X antibody
- LDH3 antibody
- ldhc antibody
- LDHC_HUMAN antibody
- LDHX antibody
- MGC111073 antibody
see all

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LDH-C antibody (ab222910)

Paraffin-embedded human small intestine tissue stained for Lactate Dehydrogenase C / LDH-C using ab222910 at 1/100 dilution in immunohistochemical analysis.
Western blot - Anti-LDH-C antibody (ab222910)

All lanes : Anti-LDH-C antibody (ab222910) at 1/500 dilution

Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 3 : Mouse brain tissue lysate
Lane 4 : Mouse heart tissue lysate
Lane 5 : Mouse lung tissue lysate
Lane 6 : Mouse thymus tissue lysate
Lane 7 : Rat liver tissue lysate

Secondary
All lanes : Goat Anti-Rabbit IgG

Predicted band size: 37 kDa
Observed band size: 37 kDa
Immunocytochemistry/ Immunofluorescence - Anti-LDH-C antibody (ab222910)

HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Lactate Dehydrogenase C / LDH-C (green) using ab222910 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488^® conjugated Goat Anti-Rabbit IgG (H+L).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LDH-C antibody (ab222910)

Paraffin-embedded human testis tissue stained for Lactate Dehydrogenase C / LDH-C using ab222910 at 1/100 dilution in immunohistochemical analysis.

ab222910 has not yet been referenced specifically in any publications.

Publishing research using ab222910? Please let us know so that we can cite the reference in this datasheet.

Anti-LDH-C antibody (ab222910)

Customer reviews and Q&As