Overview

  • Product name

    Anti-LDL Receptor antibody [1B10H10]
    See all LDL Receptor primary antibodies
  • Description

    Mouse monoclonal [1B10H10] to LDL Receptor
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LDL Receptor aa 22-150. (Purified from E.coli).
    Sequence:

    AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSG DFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKC ISRQFVCDSDRDCLDGSDEASCPVLTCGP


    Database link: P01130

  • Positive control

    • Recombinant Human LDL Receptor (aa22-150) protein; LDL Receptor (aa22-150)-hIgGFc transfected HEK293 cell lysate; Human ovarian cancer tissue; HeLa cells.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR299695-5 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab204941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 95 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.
  • Involvement in disease

    Defects in LDLR are the cause of familial hypercholesterolemia (FH) [MIM:143890]; a common autosomal semi-dominant disease that affects about 1 in 500 individuals. The receptor defect impairs the catabolism of LDL, and the resultant elevation in plasma LDL-cholesterol promotes deposition of cholesterol in the skin (xanthelasma), tendons (xanthomas), and coronary arteries (atherosclerosis).
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 3 EGF-like domains.
    Contains 7 LDL-receptor class A domains.
    Contains 6 LDL-receptor class B repeats.
  • Post-translational
    modifications

    N- and O-glycosylated.
    Ubiquitinated by MYLIP leading to degradation.
  • Cellular localization

    Cell membrane. Endomembrane system. Membrane > clathrin-coated pit. Found distributed from the plasma membrane to intracellular compartments.
  • Information by UniProt
  • Database links

  • Alternative names

    • FH antibody
    • FHC antibody
    • LDL R antibody
    • LDL receptor antibody
    • LDLCQ2 antibody
    • Ldlr antibody
    • LDLR_HUMAN antibody
    • Low Density Lipoprotein Receptor antibody
    • Low density lipoprotein receptor class A domain containing protein 3 antibody
    • Low density lipoprotein receptor familial hypercholesterolemia antibody
    • Low-density lipoprotein receptor antibody
    see all

Images

  • Anti-LDL Receptor antibody [1B10H10] (ab204941) at 1/500 dilution + Recombinant Human LDL Receptor (aa22-150) protein

    Predicted band size: 95 kDa



    Expected MWt is 40.1 kDa.

  • All lanes : Anti-LDL Receptor antibody [1B10H10] (ab204941) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : LDL Receptor (aa22-150)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 95 kDa

  • Flow cytometric analysis of HeLa cells labeling LDL Receptor with ab204941 at 1/200 dilution (green), compared to a negative control (red).

  • Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling LDL Receptor with ab204941 at 1/200 dilution with DAB staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up