Overview

  • Product name

    Anti-LEAP2 antibody
  • Description

    Rabbit polyclonal to LEAP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Cow, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human LEAP2 aa 23-76. N-terminal His-tag and GST-tag (Expressed in E.coli).
    Sequence:

    SPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSL SVAQ


    Database link: Q969E1

  • Positive control

    • WB: Pig liver and skeletal muscle tissues; Recombinant human LEAP2 protein. IHC-P: Human prostate gland and rectum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 9 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for LEAP2 using ab231955 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human prostate gland tissue stained for LEAP2 using ab231955 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-LEAP2 antibody (ab231955) at 2 µg/ml + Recombinant human LEAP2 protein

    Predicted band size: 9 kDa

  • All lanes : Anti-LEAP2 antibody (ab231955) at 3 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : Pig skeletal muscle tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 9 kDa

References

ab231955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up