Overview

  • Product name

    Anti-LECT1 antibody
  • Description

    Rabbit polyclonal to LECT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human LECT1 aa 75-334.
    Sequence:

    VHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIR FAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVA VDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTT TKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDP RLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCS WWVARILGMV


    Database link: O75829

  • Positive control

    • IHC-P: Human lung cancer and heart tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.
  • Tissue specificity

    Detected in cartilage and cardiac valves (at protein level). Detected in the laminae fibrosa, spongiosa and ventricularis layers of normal cardiac valves (at protein level). Expression is decreased cardiac valves of patients with valvular heart disease (at protein level). Weakly expressed in chondrosarcoma.
  • Sequence similarities

    Belongs to the chondromodulin-1 family.
    Contains 1 BRICHOS domain.
  • Developmental stage

    Expressed at 9 weeks in developing cartilagenous bone rudiments.
  • Post-translational
    modifications

    After cleavage, the post-translationally modified ChM-I is secreted as a glycoprotein.
  • Cellular localization

    Endomembrane system and Secreted. Accumulated in the inter-territorial matrix of cartilage.
  • Information by UniProt
  • Database links

  • Alternative names

    • BRICD3 antibody
    • BRICHOS domain containing 3 antibody
    • CH-SP antibody
    • CHM I antibody
    • ChM-I antibody
    • CHM1 antibody
    • chondromodulin antibody
    • Chondromodulin I antibody
    • Chondromodulin-1 antibody
    • Chondromodulin-I antibody
    • Chondrosurfactant protein antibody
    • LECT 1 antibody
    • Lect1 antibody
    • LECT1_HUMAN antibody
    • Leukocyte cell derived chemotaxin 1 antibody
    • Multiple myeloma tumor suppressor 1 antibody
    • MYETS1 antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for LECT1 using ab234782 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for LECT1 using ab234782 at 1/100 dilution in immunohistochemical analysis.

References

ab234782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up