Overview

  • Product name
    Anti-LECT2 antibody [OTI2A11]
    See all LECT2 primary antibodies
  • Description
    Mouse monoclonal [OTI2A11] to LECT2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LECT2 aa 19-151. Produced in E.coli (NP_002293). aa 1-18 are the signal peptide, immunogen is to the full length mature chain.
    Sequence:

    GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYA PFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGE KLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL


    Database link: O14960

  • Positive control
    • WB: HEK293T cell lysate transfected with pCMV6-ENTRY LECT2 cDNA. IHC-P: Human breast, Kidney, Lung carcinoma, Ovary adenocarcinoma, Pancreas, Endometrium adenocarcinoma and Tonsil tissues.
  • General notes

    The clone number has been updated from 2A11 to OTI2A11, both clone numbers name the same clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab119429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 16 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.
  • Tissue specificity
    Highly expressed in adult and fetal liver and weakly in testis. Not expressed in bone marrow.
  • Sequence similarities
    Belongs to the LECT2/MIM-1 family.
  • Cellular localization
    Cytoplasm. Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • chm II antibody
    • chm2 antibody
    • Chondromodulin II antibody
    • hLECT2 antibody
    • LECT 2 antibody
    • LECT-2 antibody
    • LECT2 antibody
    • LECT2_HUMAN antibody
    • Leukocyte cell derived chemotaxin 2 antibody
    • Leukocyte cell-derived chemotaxin-2 antibody
    • MGC126628 antibody
    see all

Images

  • All lanes : Anti-LECT2 antibody [OTI2A11] (ab119429) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY LECT2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 16 kDa

  • Paraffin-embedded human breast tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human kidney tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human lung carcinoma tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human pancreas tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human tonsil tissue stained for LECT2 using ab119429 at 1/150 dilution in immunohistochemical analysis.

     

References

ab119429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up