Overview

  • Product name

  • Description

    Rabbit polyclonal to LEFTY2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LEFTY2 aa 57-366.
    Sequence:

    VRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQR LPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDG SNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQRE HLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAP MTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAF NWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASD GALVPRRLQP


    Database link: O00292

  • Positive control

    • WB: A431 whole cell lysate. IHC-P: Human endometrial and colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 41 kDa (predicted molecular weight: 41, 37 kDa).

Target

  • Function

    Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
  • Tissue specificity

    Mesenchymal cells of the endometrial stroma.
  • Involvement in disease

    Defects in LEFTY2 are the cause of left-right axis malformations (LRAM) [MIM:601877]. The defect includes left pulmonary isomerism, with cardiac anomalies characterized by complete atrioventricular canal defect and hypoplastic left ventricle, and interrupted inferior vena cava.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Developmental stage

    Transiently expressed before and during menstrual bleeding.
  • Post-translational
    modifications

    The processing of the protein may also occur at the second R-X-X-R site located at AA 132-135. Processing appears to be regulated in a cell-type specific manner.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EBAF antibody
    • Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily) antibody
    • Endometrial bleeding associated factor antibody
    • Endometrial bleeding-associated factor antibody
    • Left right determination factor 2 antibody
    • Left right determination factor A antibody
    • Left-right determination factor 2 antibody
    • Left-right determination factor A antibody
    • LEFTA antibody
    • LEFTY 2 antibody
    • LEFTY2 antibody
    • LEFTYA antibody
    • LFTY2 transforming growth factor, beta -4 antibody
    • LFTY2, mouse, homolog of antibody
    • LFTY2_HUMAN antibody
    • MGC46222 antibody
    • Protein lefty 2 antibody
    • Protein lefty A antibody
    • Protein lefty-2 antibody
    • Protein lefty-A antibody
    • Protein lefty2 antibody
    • PSEC0024 antibody
    • TGF beta 4 antibody
    • TGF-beta-4 antibody
    • TGFB4 antibody
    • Transforming growth factor beta 4 antibody
    • Transforming growth factor beta-4 antibody
    see all

Images

  • Anti-LEFTY2 antibody (ab229668) at 1/1000 dilution + A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    Goat anti-rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 41, 37 kDa
    Observed band size: 41 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human endometrial cancer tissue stained for LEFTY2 using ab229668 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for LEFTY2 using ab229668 at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Gao X  et al. miR-215 promotes epithelial to mesenchymal transition and proliferation by regulating LEFTY2 in endometrial cancer. Int J Mol Med 42:1229-1236 (2018). Read more (PubMed: 29845221) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up