Anti-Legumain antibody (ab232870)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Legumain antibody
See all Legumain primary antibodies -
Description
Rabbit polyclonal to Legumain -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Macaque monkey, Orangutan
-
Immunogen
Recombinant full length protein (His-T7-tag) corresponding to Human Legumain aa 18-433. N-terminal tags. Expressed in E. coli. Full length mature chain including propeptide, not including signal peptide.
Sequence:VPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIV VMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVL RGDAEAVKGIGSGKVLKSGPQDHVFIYFTDHGSTGILVFPNEDLHVKDLN ETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPRESSY ACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHV MQYGNKTISTMKVMQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKR KLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLL SERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYP LHRIKLSMDHVCLGHY
Database link: Q99538 -
Positive control
- WB: Recombinant human Legumain protein and rat placenta tissue. IHC-P: Human breast cancer, kidney, stomach, colorectal cancer, prostate and prostate cancer tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab232870 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 49 kDa. |
Target
-
Function
Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. -
Tissue specificity
Ubiquitous. Particularly abundant in kidney, heart and placenta. -
Sequence similarities
Belongs to the peptidase C13 family. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 5641 Human
- Entrez Gene: 100173793 Orangutan
- Omim: 602620 Human
- SwissProt: Q99538 Human
- SwissProt: Q5R5D9 Orangutan
- Unigene: 726036 Human
-
Alternative names
- AEP antibody
- Asparaginyl endopeptidase antibody
- cysteine 1 antibody
see all
Images
-
Western blot - Anti-Legumain antibody (ab232870)Anti-Legumain antibody (ab232870) at 1 µg/ml + Rat placenta tissue lysate
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 49 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human kidney tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human stomach tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human prostate tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab232870)Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Legumain using ab232870 at 30 μg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Western blot - Anti-Legumain antibody (ab232870)Anti-Legumain antibody (ab232870) at 1 µg/ml + Recombinant human Legumain protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 49 kDa
References
ab232870 has not yet been referenced specifically in any publications.
