Anti-Legumain antibody (ab244251)
Key features and details
- Rabbit polyclonal to Legumain
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Legumain antibody
See all Legumain primary antibodies -
Description
Rabbit polyclonal to Legumain -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human Legumain aa 284-433.
Sequence:QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTE EIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEAL LHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
Database link: Q99538 -
Positive control
- IHC-P: Human placenta, prostate and gastrointestinal tissue ICC/IF: RT4 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244251 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. -
Tissue specificity
Ubiquitous. Particularly abundant in kidney, heart and placenta. -
Sequence similarities
Belongs to the peptidase C13 family. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 101867471 Cynomolgus monkey
- Entrez Gene: 5641 Human
- Entrez Gene: 100173793 Orangutan
- Omim: 602620 Human
- SwissProt: Q4R4T8 Cynomolgus monkey
- SwissProt: Q99538 Human
- SwissProt: Q5R5D9 Orangutan
- Unigene: 726036 Human
-
Alternative names
- AEP antibody
- Asparaginyl endopeptidase antibody
- cysteine 1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)
Paraffin-embedded human prostate stained for Legumain using ab244251 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)
Paraffin-embedded human gastrointestinal stained for Legumain using ab244251 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)
Paraffin-embedded human tonsil stained for Legumain using ab244251 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)
Paraffin-embedded human placenta stained for Legumain using ab244251 at 1/20 dilution in immunohistochemical analysis.
-
PFA fixed, Triton X-100 permeabilized RT4 (Human urinary bladder cancer cell line) cells labeling Legumain using ab244251 at 4 µg/ml (green) in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244251 has not yet been referenced specifically in any publications.