Anti-Legumain antibody (ab244251)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Legumain antibody
See all Legumain primary antibodies -
Description
Rabbit polyclonal to Legumain -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human Legumain aa 284-433.
Sequence:QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTE EIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEAL LHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
Database link: Q99538 -
Positive control
- IHC-P: Human placenta tissue. ICC/IF: RT4 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244251 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. -
Tissue specificity
Ubiquitous. Particularly abundant in kidney, heart and placenta. -
Sequence similarities
Belongs to the peptidase C13 family. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 101867471 Cynomolgus monkey
- Entrez Gene: 5641 Human
- Entrez Gene: 100173793 Orangutan
- Omim: 602620 Human
- SwissProt: Q4R4T8 Cynomolgus monkey
- SwissProt: Q99538 Human
- SwissProt: Q5R5D9 Orangutan
- Unigene: 726036 Human
-
Alternative names
- AEP antibody
- Asparaginyl endopeptidase antibody
- cysteine 1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Legumain antibody (ab244251)PFA fixed, Triton X-100 permeabilized RT4 (Human urinary bladder cancer cell line) cells labeling Legumain using ab244251 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)Formalin-fixed, paraffin-embedded human placenta tissue stained for Legumain with ab244251 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Legumain antibody (ab244251)Formalin-fixed, paraffin-embedded human pancreas tissue stained for Legumain with ab244251 at a 1/50 dilution in immunohistochemical analysis.
Low expression as expected.
Datasheets and documents
References
ab244251 has not yet been referenced specifically in any publications.
