Overview

  • Product name

    Anti-LENG8 antibody
  • Description

    Rabbit polyclonal to LENG8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human LENG8 aa 489-664. (BC028048).
    Sequence:

    KRSRKKMAALECEDPERELKKQKRAARFQHGHSRRLRLEPLVLQMSSLES SGADPDWQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKC HWKEKQDYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHE EFNQCQTQLKSLYAENLPGNVGEFTA


    Database link: Q96PV6-2

  • Positive control

    • IHC-P: Human thymus and prostate tissues. WB: Human fetal heart and kidney lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 88 kDa.
IHC-P Use a concentration of 5 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for LENG8 using ab230864 at 5 µg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human thymus tissue stained for LENG8 using ab230864 at 5 µg/ml in immunohistochemical analysis.

  • All lanes : Anti-LENG8 antibody (ab230864) at 1/1000 dilution

    Lane 1 : Human fetal heart lysate
    Lane 2 : Human kidney lysate

    Predicted band size: 88 kDa

References

ab230864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up