Overview

  • Product name

    Anti-LEP2 antibody
  • Description

    Rabbit polyclonal to LEP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LEP2 aa 1-118.
    Sequence:

    MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGG CCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPS GGSSCCGGGSGQHSGGCC


    Database link: Q5T7P3

  • Positive control

    • ICC/IF: A-375 (human malignant melanoma cell line) cells. IHC-P: Human skin tissue.
  • General notes

     This product was previously labelled as Late cornified envelope protein 1B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Precursors of the cornified envelope of the stratum corneum.
  • Tissue specificity

    Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta.
  • Sequence similarities

    Belongs to the LCE family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Late cornified envelope protein 1B antibody
    • Late envelope protein 2 antibody
    • LCE1B antibody
    • LCE1B_HUMAN antibody
    • LEP2 antibody
    • Small proline-rich-like epidermal differentiation complex protein 2A antibody
    • SPRL2A antibody
    see all

Images

  • Paraffin embedded human skin tissue stained for LEP2 with ab222796 at a 1/100 dilution.

  • A-375 (human malignant melanoma cell line) cells stained for LEP2 (green) using ab222796 at a 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab222796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up