Anti-LEPRE1/P3H1 antibody (ab244326)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-LEPRE1/P3H1 antibody
See all LEPRE1/P3H1 primary antibodies -
Description
Rabbit polyclonal to LEPRE1/P3H1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human LEPRE1/P3H1 aa 320-446.
Sequence:AVECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRESAKEYRQRS LLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQ EIGNLMKEIETLVEEKTKESLDVSRLT
Database link: Q32P28 -
Positive control
- WB: U-2 OS cell lysate. IHC-P: Human placenta tissue.
-
General notes
This product was previously labelled as LEPRE1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244326 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Basement membrane-associated chondroitin sulfate proteoglycan (CSPG). Has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. May be involved in the secretory pathway of cells. Has growth suppressive activity in fibroblasts. -
Involvement in disease
Defects in LEPRE1 are the cause of osteogenesis imperfecta type 8 (OI8) [MIM:610915]. A connective tissue disorder characterized by disproportionate short stature, severe osteoporosis, shortening of the long bones, white sclerae, a round face and a short barrel-shaped chest. -
Sequence similarities
Belongs to the leprecan family.
Contains 1 Fe2OG dioxygenase domain.
Contains 4 TPR repeats. -
Post-translational
modificationsO-glycosylated; chondroitin sulfate. -
Cellular localization
Endoplasmic reticulum. Secreted > extracellular space > extracellular matrix. Secreted into the extracellular matrix as a chondroitin sulfate proteoglycan. - Information by UniProt
-
Database links
- Entrez Gene: 64175 Human
- Entrez Gene: 56401 Mouse
- Entrez Gene: 114200 Rat
- Omim: 610339 Human
- SwissProt: Q32P28 Human
- SwissProt: Q3V1T4 Mouse
- SwissProt: Q9R1J8 Rat
- Unigene: 720014 Human
see all -
Alternative names
- GROS 1 antibody
- GROS1 antibody
- Growth suppressor 1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)Formalin-fixed, paraffin-embedded human placenta tissue stained for LEPRE1/P3H1 with ab244326 at a 1/50 dilution in immunohistochemical analysis.
-
Western blot - Anti-LEPRE1/P3H1 antibody (ab244326)All lanes : Anti-LEPRE1/P3H1 antibody (ab244326) at 0.4 µg/ml
Lane 1 : U-2 OS (Human bone osteosarcoma epithelial cell line) cell lysate
Lane 2 : MCF7 (Human breast adenocarcinoma cell line) cell lysate
Datasheets and documents
References
ab244326 has not yet been referenced specifically in any publications.
