Anti-LEPRE1/P3H1 antibody (ab244326)
Key features and details
- Rabbit polyclonal to LEPRE1/P3H1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LEPRE1/P3H1 antibody
See all LEPRE1/P3H1 primary antibodies -
Description
Rabbit polyclonal to LEPRE1/P3H1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human LEPRE1/P3H1 aa 320-446.
Sequence:AVECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRESAKEYRQRS LLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQ EIGNLMKEIETLVEEKTKESLDVSRLT
Database link: Q32P28 -
Positive control
- WB: U-2 OS cell lysate. IHC-P: Human placenta, liver, prostate and cervix tissue.
-
General notes
This product was previously labelled as LEPRE1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244326 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Basement membrane-associated chondroitin sulfate proteoglycan (CSPG). Has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. May be involved in the secretory pathway of cells. Has growth suppressive activity in fibroblasts. -
Involvement in disease
Defects in LEPRE1 are the cause of osteogenesis imperfecta type 8 (OI8) [MIM:610915]. A connective tissue disorder characterized by disproportionate short stature, severe osteoporosis, shortening of the long bones, white sclerae, a round face and a short barrel-shaped chest. -
Sequence similarities
Belongs to the leprecan family.
Contains 1 Fe2OG dioxygenase domain.
Contains 4 TPR repeats. -
Post-translational
modificationsO-glycosylated; chondroitin sulfate. -
Cellular localization
Endoplasmic reticulum. Secreted > extracellular space > extracellular matrix. Secreted into the extracellular matrix as a chondroitin sulfate proteoglycan. - Information by UniProt
-
Database links
- Entrez Gene: 64175 Human
- Entrez Gene: 56401 Mouse
- Entrez Gene: 114200 Rat
- Omim: 610339 Human
- SwissProt: Q32P28 Human
- SwissProt: Q3V1T4 Mouse
- SwissProt: Q9R1J8 Rat
- Unigene: 720014 Human
see all -
Alternative names
- GROS 1 antibody
- GROS1 antibody
- Growth suppressor 1 antibody
see all
Images
-
All lanes : Anti-LEPRE1/P3H1 antibody (ab244326) at 0.4 µg/ml
Lane 1 : U-2 OS (Human bone osteosarcoma epithelial cell line) cell lysate
Lane 2 : MCF7 (Human breast adenocarcinoma cell line) cell lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)
Formalin-fixed, paraffin-embedded human placenta tissue stained for LEPRE1/P3H1 with ab244326 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)
Formalin-fixed, paraffin-embedded human liver tissue stained for LEPRE1/P3H1 with ab244326 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)
Formalin-fixed, paraffin-embedded human prostate tissue stained for LEPRE1/P3H1 with ab244326 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)
Formalin-fixed, paraffin-embedded human cervix tissue stained for LEPRE1/P3H1 with ab244326 at a 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LEPRE1/P3H1 antibody (ab244326)
Formalin-fixed, paraffin-embedded human pancreas tissue shows absence of immunoreactivity for LEPRE1/P3H1 when incubated with ab244326 at a 1/50 dilution (negative control).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244326 has not yet been referenced specifically in any publications.