Overview

  • Product name

    Anti-Leptin antibody [AT7E10]
    See all Leptin primary antibodies
  • Description

    Mouse monoclonal [AT7E10] to Leptin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Goat, Cow, Cat, Pig, Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human Leptin aa 22-167. (Purified from E.coli).
    Sequence:

    VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILT LSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPW ASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC


    Database link: P41159

  • Positive control

    • Leptin transfected 293T cell lysate; HeLa cells.
  • General notes

    Clone AT7E10 is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human Leptin protein.

    This product was changed from ascites to tissue culture supernatant on 08/08/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab219260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 19 kDa.
ICC/IF Use at an assay dependent concentration.

Target

Images

  • All lanes : Anti-Leptin antibody [AT7E10] (ab219260) at 1/1000 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : Leptin transfected 293T cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti-Mouse secondary antibody conjugated to HRP

    Developed using the ECL technique.

    Predicted band size: 19 kDa



    This image was generated using the ascites version of the product.

  • Immunofluorescent analysis of HeLa cells labeling Leptin with ab219260 at 1/100 dilution, followed by goat anti-mouse IgG-Alexa fluor 488 conjugate (green). The lower panel shows cells counterstained with DAPI for nuclear staining (blue).

    This image was generated using the ascites version of the product.

References

ab219260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up