Overview

  • Product name

  • Description

    Rabbit polyclonal to LETM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human LETM1 aa 443-543.
    Sequence:

    IVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQKRSEVA KDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEITK E


    Database link: O95202

  • Positive control

    • WB: HeLa, MCF7, HEK-293, HepG2 and Jurkat whole cell lysates; mouse heart lysate. IHC-P: Human liver cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 83 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.

Target

  • Function

    Crucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain. Required for the maintenance of the tubular shape and cristae organization.
  • Sequence similarities

    Contains 1 EF-hand domain.
    Contains 1 LETM1 domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LETM 1 antibody
    • LETM1 and EF hand domain containing protein 1, mitochondrial antibody
    • LETM1 and EF-hand domain-containing protein 1 antibody
    • Letm1 antibody
    • LETM1_HUMAN antibody
    • Leucine zipper EF hand containing transmembrane protein 1 antibody
    • Leucine zipper-EF-hand-containing transmembrane protein 1 antibody
    • Mdm38 homolog antibody
    • mitochondrial antibody
    see all

Images

  • All lanes : Anti-LETM1 antibody (ab236743) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 6 : Mouse heart lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 83 kDa

  • Paraffin-embedded human liver cancer tissue stained for LETM1 using ab236743 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

     

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for LETM1 (green) using ab236743 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counterstain is DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab236743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up