Overview

  • Product name
  • Description
    Rabbit polyclonal to LETMD1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human LETMD1 aa 1-360.
    Sequence:

    MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPK ADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADA KKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFA NYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEK VIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQ ALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTA QEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL LSTNYLGTRR


    Database link: Q6P1Q0

  • Positive control
    • PANC1 cell extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
IHC-P 1/50 - 1/200.

Target

  • Relevance
    LETMD1 is involved in tumorigenesis and may function as a negative regulator of the TP53/p53. It is found in kidney, liver, skeletal muscle, heart and brain and is over-expressed in various tumors including leukemia, lymphoma, and carcinomas of the breast, kidney, ovary, stomach, colon and uterine cervix. There are six isoforms.
  • Cellular localization
    Membrane; Single-pass membrane protein
  • Database links
  • Alternative names
    • 1110019O13Rik antibody
    • Cervical cancer 1 proto oncogene protein antibody
    • Cervical cancer proto oncogene 2 protein antibody
    • DKFZp586A011 antibody
    • HCCR 2 antibody
    • HCCR1 antibody
    • HCCR2 antibody
    • HCRR 2 antibody
    • HCRR2 antibody
    • LETM1 domain containing 1 antibody
    • Regulator of TP53 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175410. Blue DAPI for nuclear staining.
  • Anti-LETMD1 antibody (ab175410) at 1/500 dilution + PANC1 cell extract

    Predicted band size: 42 kDa

References

ab175410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up