Anti-LETMD1/HCCR-1 antibody (ab175410)
Key features and details
- Rabbit polyclonal to LETMD1/HCCR-1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-LETMD1/HCCR-1 antibody
See all LETMD1/HCCR-1 primary antibodies -
Description
Rabbit polyclonal to LETMD1/HCCR-1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human LETMD1/HCCR-1 aa 1-360.
Sequence:MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPK ADVKNLMSYVVTKTKAINGKYHRFLGRHFPRFYVLYTIFMKGLQMLWADA KKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLFLGIISIPPFA NYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEK VIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQ ALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTA QEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL LSTNYLGTRR
Database link: Q6P1Q0 -
Positive control
- PANC1 cell extract.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175410 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 42 kDa.
|
|
IHC-P |
1/50 - 1/200.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
WB
1/500 - 1/2000. Predicted molecular weight: 42 kDa. |
IHC-P
1/50 - 1/200. |
Target
-
Relevance
LETMD1 is involved in tumorigenesis and may function as a negative regulator of the TP53/p53. It is found in kidney, liver, skeletal muscle, heart and brain and is over-expressed in various tumors including leukemia, lymphoma, and carcinomas of the breast, kidney, ovary, stomach, colon and uterine cervix. There are six isoforms. -
Cellular localization
Membrane; Single-pass membrane protein -
Database links
- Entrez Gene: 514595 Cow
- Entrez Gene: 25875 Human
- Entrez Gene: 68614 Mouse
- SwissProt: A3KN46 Cow
- SwissProt: Q6P1Q0 Human
- SwissProt: Q924L1 Mouse
-
Alternative names
- 1110019O13Rik antibody
- Cervical cancer 1 proto oncogene protein antibody
- Cervical cancer proto oncogene 2 protein antibody
see all
Images
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175410. Blue DAPI for nuclear staining.
-
Immunohistochemistry of paraffin-embedded rat kidney damage using ab175410 at dilution of 1:100
-
Immunohistochemistry of paraffin-embedded human liver damage using ab175410 at dilution of 1:100
-
All lanes : Anti-LETMD1/HCCR-1 antibody (ab175410) at 1/1000 dilution
Lane 1 : MCF7 cell lysate with 3% nonfat dry milk in TBST.
Lane 2 : Mouse liver lysate with 3% nonfat dry milk in TBST.
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/1000 dilution
Developed using the ECL technique.
Predicted band size: 42 kDa
Exposure time: 90 seconds -
Anti-LETMD1/HCCR-1 antibody (ab175410) at 1/500 dilution + PANC1 cell extract
Predicted band size: 42 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175410 has been referenced in 1 publication.
- Zhu LF et al. HCCR-1 is a Novel Prognostic Indicator for Gastric Cancer and Promotes Cell Proliferation. J Cancer 10:3533-3542 (2019). PubMed: 31293658