Overview

  • Product name

    Anti-LETMD1/HCCR-1 antibody
    See all LETMD1/HCCR-1 primary antibodies
  • Description

    Rabbit polyclonal to LETMD1/HCCR-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human LETMD1/HCCR-1 aa 162-347. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    PRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLR WRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAM LLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRG LNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHN


    Database link: Q6P1Q0

  • Positive control

    • IHC-P: Human prostate, kidney, stomach and stomach cancer tissue. WB: Recombinant human LETMD1/HCCR-1 protein; HeLa cell lysate; Cow kidney lysate.
  • General notes

     This product was previously labelled as LETMD1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    LETMD1 is involved in tumorigenesis and may function as a negative regulator of the TP53/p53. It is found in kidney, liver, skeletal muscle, heart and brain and is over-expressed in various tumors including leukemia, lymphoma, and carcinomas of the breast, kidney, ovary, stomach, colon and uterine cervix. There are six isoforms.
  • Cellular localization

    Membrane; Single-pass membrane protein
  • Database links

  • Alternative names

    • 1110019O13Rik antibody
    • Cervical cancer 1 proto oncogene protein antibody
    • Cervical cancer proto oncogene 2 protein antibody
    • DKFZp586A011 antibody
    • HCCR 2 antibody
    • HCCR1 antibody
    • HCCR2 antibody
    • HCRR 2 antibody
    • HCRR2 antibody
    • LETM1 domain containing 1 antibody
    • Regulator of TP53 antibody
    see all

Images

  • Anti-LETMD1/HCCR-1 antibody (ab233445) at 2 µg/ml + Cow kidney tissue lysate.

    Predicted band size: 42 kDa

  • Immunocytochemistry/ Immunofluorescence of HeLa cells staining LETMD1/HCCR-1 using ab233445 5 µg/mL

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for LETMD1/HCCR-1 using ab233445 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-LETMD1/HCCR-1 antibody (ab233445) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate.

    Predicted band size: 42 kDa

  • Anti-LETMD1/HCCR-1 antibody (ab233445) at 2 µg/ml + Recombinant human LETMD1/HCCR-1 protein

    Predicted band size: 42 kDa

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for LETMD1/HCCR-1 using ab233445 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for LETMD1/HCCR-1 using ab233445 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for LETMD1/HCCR-1 using ab233445 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab233445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up