Overview

  • Product name

  • Description

    Rabbit polyclonal to LeuRS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human LeuRS aa 23-105.
    Sequence:

    KWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEF AVGYQRLKGKCCLFPFGLHCTGMPIKACADKLK


    Database link: Q9P2J5

  • Positive control

    • Human urinary bladder tissue, RT-4 & U-251 MG cell line lysate, A-431 cell line
  • General notes

     This product was previously labelled as Leucyl tRNA synthetase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab204558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 134 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Catalyzes the specific attachment of an amino acid to its cognate tRNA in a two step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. Exhibits a post-transfer editing activity to hydrolyze mischarged tRNAs.
  • Involvement in disease

    Infantile liver failure syndrome 1
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • cytoplasmic antibody
    • Cytoplasmic leucyl tRNA synthetase antibody
    • Cytosolic leucyl tRNA synthetase antibody
    • FLJ10595 antibody
    • FLJ21788 antibody
    • hr025Cl antibody
    • HSPC 192 antibody
    • HSPC192 antibody
    • KIAA1352 antibody
    • LARS 1 antibody
    • Lars antibody
    • LARS1 antibody
    • Leucine translase antibody
    • Leucine tRNA ligase antibody
    • Leucine--tRNA ligase antibody
    • Leucyl tRNA synthetase cytoplasmic antibody
    • Leucyl-tRNA synthetase antibody
    • LeuRS antibody
    • LEUS antibody
    • LRS antibody
    • PIG 44 antibody
    • PIG44 antibody
    • Proliferation inducing gene 44 antibody
    • RNTLS antibody
    • SYLC_HUMAN antibody
    see all

Images

  • All lanes : Anti-LeuRS antibody (ab204558) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 134 kDa

  • Immunohistochemical analysis of paraffin-embedded Human urinary bladder tissue labeling LeuRS with ab204558 at 1/20 dilution.

References

This product has been referenced in:

  • Gretzmeier C  et al. Degradation of protein translation machinery by amino acid starvation-induced macroautophagy. Autophagy 13:1064-1075 (2017). Read more (PubMed: 28453381) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up