Overview

  • Product name

    Anti-LexA DNA Binding Region antibody
    See all LexA DNA Binding Region primary antibodies
  • Description

    Rabbit polyclonal to LexA DNA Binding Region
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Escherichia coli, Shigella flexneri
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli LexA DNA Binding Region aa 1-202.
    Sequence:

    MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKAL ARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQV DPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARID DEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGD WL


    Database link: P0A7C2

  • Positive control

    • WB: Recombinant Escherichia coli LexA DNA Binding Region protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab234695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 39 kDa (predicted molecular weight: 39 kDa).

Target

  • Relevance

    The LexA protein of Escherichia coli is a transcriptional repressor regulating approximately 20 genes, many of which are involved in DNA repair (SOS response). It binds with variable affinity to single, double, or even triple-operators via its amino-terminal domain that contains three alpha-helices spanning residues. This characteristic of LexA protein has been used to make efficient baits for two-hybrid studies.
  • Cellular localization

    Nuclear
  • Database links

    • Alternative names

      • ExrA antibody
      • Lex A antibody
      • LexA antibody
      • LexA repressor antibody
      • Spr antibody
      • Tsl antibody
      • UmuA antibody
      see all

    Images

    • All lanes : Anti-LexA DNA Binding Region antibody (ab234695) at 1/500 dilution

      Lane 1 : Recombinant Escherichia coli LexA Binding Region protein, 80 ng
      Lane 2 : Recombinant Escherichia coli LexA Binding Region protein, 40 ng
      Lane 3 : Recombinant Escherichia coli LexA Binding Region protein, 20 ng
      Lane 4 : Recombinant Escherichia coli LexA Binding Region protein, 10 ng

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 39 kDa
      Observed band size: 39 kDa

    References

    ab234695 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab234695.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up