Overview

  • Product name

  • Description

    Rabbit polyclonal to LGALS3BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human LGALS3BP aa 383-412 (internal sequence). (NP_005558.1)
    Sequence:

    LEFHTVPFQLLARYKGLNLTEDTYKPRIYTSP


    Database link: Q08380

  • Positive control

    • Mouse lung tissue lysates and Human prostate tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 65 kDa.
IHC-P 1/75.

Target

  • Function

    Promotes intergrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
  • Tissue specificity

    Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts.
  • Sequence similarities

    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Secreted. Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 90K antibody
    • 90K MAC 2 BP antibody
    • Basement membrane autoantigen p105 antibody
    • BTBD17B antibody
    • Galectin 3 binding protein antibody
    • Galectin-3-binding protein antibody
    • L3 antigen antibody
    • Lectin galactoside binding soluble 3 binding protein antibody
    • Lectin galactoside-binding soluble 3-binding protein antibody
    • LG3BP_HUMAN antibody
    • LGALS3BP antibody
    • M2BP antibody
    • Mac 2 binding protein antibody
    • Mac 2 BP antibody
    • Mac-2 BP antibody
    • Mac-2-binding protein antibody
    • Mac2 BP antibody
    • MAC2BP antibody
    • Serum protein 90K antibody
    • TANGO10B antibody
    • Transport and golgi organization 10 homolog B antibody
    • Tumor associated antigen 90K antibody
    • Tumor-associated antigen 90K antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate tissue labeling LGALS3BP with ab191186 at 1/75 dilution.

  • Anti-LGALS3BP antibody (ab191186) at 1/1000 dilution + Mouse lung tissue lysates at 35 µg

    Predicted band size: 65 kDa

References

ab191186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up