Overview

  • Product name

    Anti-LGALS3BP antibody [OTI3D6]
    See all LGALS3BP primary antibodies
  • Description

    Mouse monoclonal [OTI3D6] to LGALS3BP
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human LGALS3BP aa 19-300. (NP_005558) produced in E.coli.
    Sequence:

    VNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFE NATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERD AGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALG FCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRID ITLSSVKCFHKLASAYGARQLQGYCASLFAILLPQDPSFQMPLDLYAYAV ATGDALLEKLCLQFLAWNFEALTQAEAWPSVP


    Database link: Q08380

  • Positive control

    • WB: HEK-293T transfected with r pCMV6-ENTRY LGALS3BP cDNA, whole cell lysate. IHC-P: Human lung carcinoma, endometrium adenocarcinoma, prostate and bladder carcinoma tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY LGALS3BP cDNA. Flow: HEK-293T cells.
  • General notes

    Clone OTI3D6 (formerly 3D6).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI3D6
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat induced epitope retrieval by 10mM citric buffer, pH 6.0, 100°C for 10 minutes.

WB 1/500 - 1/2000. Predicted molecular weight: 65 kDa.
Flow Cyt 1/100.
ICC/IF 1/100.

Target

  • Function

    Promotes intergrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
  • Tissue specificity

    Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts.
  • Sequence similarities

    Contains 1 BACK (BTB/Kelch associated) domain.
    Contains 1 BTB (POZ) domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Secreted. Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 90K antibody
    • 90K MAC 2 BP antibody
    • Basement membrane autoantigen p105 antibody
    • BTBD17B antibody
    • Galectin 3 binding protein antibody
    • Galectin-3-binding protein antibody
    • L3 antigen antibody
    • Lectin galactoside binding soluble 3 binding protein antibody
    • Lectin galactoside-binding soluble 3-binding protein antibody
    • LG3BP_HUMAN antibody
    • LGALS3BP antibody
    • M2BP antibody
    • Mac 2 binding protein antibody
    • Mac 2 BP antibody
    • Mac-2 BP antibody
    • Mac-2-binding protein antibody
    • Mac2 BP antibody
    • MAC2BP antibody
    • Serum protein 90K antibody
    • TANGO10B antibody
    • Transport and golgi organization 10 homolog B antibody
    • Tumor associated antigen 90K antibody
    • Tumor-associated antigen 90K antibody
    see all

Images

  • All lanes : Anti-LGALS3BP antibody [OTI3D6] (ab236509) at 1/500 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control cDNA, whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY LGALS3BP cDNA, whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 65 kDa

  • Paraffin-embedded human lung carcinoma tissue stained for LGALS3BP using ab236509 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for LGALS3BP using ab236509 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for LGALS3BP using ab236509 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for LGALS3BP using ab236509 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transfected with pCMV6-ENTRY LGALS3BP cDNA stained for LGALS3BP (green) using ab236509 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with empty vector control (blue) or vector expressing LGALS3BP (red), labeling LGALS3BP with ab236509 at 1/100 dilution.

References

ab236509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up