Overview

  • Product name

    Anti-LGB antibody - BSA and Azide free
    See all LGB primary antibodies
  • Description

    Rabbit polyclonal to LGB - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
  • Species reactivity

    Reacts with: Sheep, Goat, Cow
  • Immunogen

    Full length native protein (purified) corresponding to Cow LGB aa 17-178.
    Sequence:

    LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTP EGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYK KYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLS FNPTQLEEQCHI


    Database link: P02754

  • General notes

     This product was previously labelled as Lactoglobulin beta

     

Properties

  • Form

    Lyophilised:Reconstitute in 1 ml sterile distilled water
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

Use 2 μl or equivalent against 120 μl test sample.

Target

  • Function

    Primary component of whey, it binds retinol and is probably involved in the transport of that molecule.
  • Tissue specificity

    Synthesized in mammary gland and secreted in milk.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Post-translational
    modifications

    Alternate disulfide bonds occur in equal amounts in all variants examined.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta lactoglobulin B antibody
    • Beta-lactoglobulin antibody
    • Beta-LG antibody
    • BLG antibody
    • LACB_BOVIN antibody
    • LGB antibody
    see all

References

ab182950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up