Overview

  • Product name

  • Description

    Rabbit polyclonal to LGN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LGN aa 353-495.
    Sequence:

    REVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPK LGRRHSMENMELMKLTPEKVQNWNSEILAKQKPLIAKPSAKLLFVNRLKG KKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTIGDEGFFDL


    Database link: P81274

  • Positive control

    • WB: SK-BR-3 cell lysate. IHC-P: Human cerebellum tissue. ICC/IF: U-251 MG cells.
  • General notes

    Protein previously labeled as GPSM2.

Properties

Applications

Our Abpromise guarantee covers the use of ab224238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 77 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Plays an important role in spindle pole orientation. Interacts and contributes to the functional activity of G(i) alpha proteins. Acts to stabilize the apical complex during neuroblast divisions.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in GPSM2 are the cause of deafness autosomal recessive type 82 (DFNB82) [MIM:613557]. DFNB82 is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss. There are no symptoms of vestibular dysfunction.
  • Sequence similarities

    Belongs to the GPSM family.
    Contains 4 GoLoco domains.
    Contains 8 TPR repeats.
  • Cellular localization

    Cytoplasm. Cytoplasm > cell cortex. Localizes in the cytoplasm in the interphase and at cell periphery in the metaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • DFNB82 antibody
    • G protein signalling modulator 2 (AGS3 like C. elegans) antibody
    • G protein signalling modulator 2 antibody
    • G-protein-signaling modulator 2 antibody
    • Gpsm2 antibody
    • GPSM2_HUMAN antibody
    • HGNC:29501 antibody
    • LGN antibody
    • LGN protein antibody
    • Mosaic protein LGN antibody
    • Pins antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for LGN (green) using ab224238 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human cerebellum tissue stained for LGN using ab224238 at 1/500 dilution in immunohistochemical analysis.

  • Anti-LGN antibody (ab224238) at 1/100 dilution + SK-BR-3 (human mammary gland adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 77 kDa

References

ab224238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up