Overview

  • Product name

  • Description

    Rabbit polyclonal to LHFPL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human LHFPL5 aa 46-99.
    Sequence:

    QPYWIGDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFK TAMF


    Database link: Q8TAF8

  • Positive control

    • IHC-P: Human testis and skeletal muscle tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May function in hair bundle morphogenesis.
  • Involvement in disease

    Defects in LHFPL5 are a cause of deafness autosomal recessive type 67 (DFNB67) [MIM:610265]. DFNB67 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the LHFP family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deafness, autosomal recessive 67 antibody
    • DFNB67 antibody
    • dJ510O8.8 antibody
    • LHFP-like protein 5 antibody
    • LHFPL5 antibody
    • Lipoma HMGIC fusion partner-like 5 antibody
    • Lipoma HMGIC fusion partner-like 5 protein antibody
    • MGC33835 antibody
    • OTTHUMP00000016278 antibody
    • Tetraspan membrane protein of hair cell stereocilia antibody
    • TMHS antibody
    • TMHS_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for LHFPL5 using ab234809 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for LHFPL5 using ab234809 at 1/100 dilution in immunohistochemical analysis.

  • A549 (Human lung carcinoma cell line) cells labeling LHFPL5 using ab234809 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up