Overview

  • Product name

  • Description

    Rabbit polyclonal to Lhx4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Lhx4 aa 226-290.
    Sequence:

    QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYG NVGDVTGGQLMNGSF


    Database link: Q969G2

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May play a critical role in the development of respiratory control mechanisms and in the normal growth and maturation of the lung.
  • Involvement in disease

    Defects in LHX4 are the cause of pituitary hormone deficiency combined type 4 (CPHD4) [MIM:262700]; also known as short stature pituitary and cerebellar defects and small sella turcica. The disorder is characterized by short stature, pituitary and cerebellar defects, and small transverse depression crossing the midline on the superior surface of the body of the sphenoid bone which houses the pituitary gland.
    Note=A chromosomal aberration involving LHX4 may be a cause of acute lymphoblastic leukemia. Translocation t(1;14)(q25;q32) with IGHG1.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CPHD4 antibody
    • Gsh 4 antibody
    • Gsh4 antibody
    • Lhx4 antibody
    • LHX4_HUMAN antibody
    • LIM Homeobox 4 antibody
    • LIM Homeobox gene 4 antibody
    • LIM homeobox protein 4 antibody
    • LIM/homeobox protein Lhx4 antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-2 OS cells labeling Lhx4 with ab220758 at 4 μg/ml dilution (green). 

References

ab220758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up