Anti-LHX6 antibody (ab22885)
Key features and details
- Rabbit polyclonal to LHX6
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LHX6 antibody
See all LHX6 primary antibodies -
Description
Rabbit polyclonal to LHX6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Guinea pig, Cow, Dog -
Immunogen
Synthetic peptide within Human LHX6 (C terminal). The exact sequence is proprietary.
Sequence:LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS
-
Positive control
- WB: Human 293T cell lysate. IHC-P: Human liver tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab22885 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.
Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
IHC-P |
Use a concentration of 4 - 8 µg/ml.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
IHC-P
Use a concentration of 4 - 8 µg/ml. |
Target
-
Function
Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex. -
Sequence similarities
Contains 1 homeobox DNA-binding domain.
Contains 2 LIM zinc-binding domains. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 26468 Human
- Entrez Gene: 16874 Mouse
- Entrez Gene: 311901 Rat
- Omim: 608215 Human
- SwissProt: Q9UPM6 Human
- SwissProt: O88706 Mouse
- SwissProt: Q6P1H2 Mouse
- SwissProt: Q9R1R0 Mouse
see all -
Alternative names
- LHX 6 antibody
- LHX 6.1 antibody
- LHX6 antibody
see all
Images
-
Anti-LHX6 antibody (ab22885) at 1 µg/ml + Human 293T cell lysate at 10 µg
Predicted band size: 40 kDaWestern blot analysis of human 293T cell lysate labeling LHX6 with ab22885.
-
Immunohistochemical analysis of LHX6 expression in paraffin embedded human liver tissue. ab22885 was used at 4 ug/ml. Arrows indicate positively labelled hepatocytes.
Protocols
Datasheets and documents
-
Datasheet download
References (5)
ab22885 has been referenced in 5 publications.
- Xu R et al. OLIG2 Drives Abnormal Neurodevelopmental Phenotypes in Human iPSC-Based Organoid and Chimeric Mouse Models of Down Syndrome. Cell Stem Cell 24:908-926.e8 (2019). PubMed: 31130512
- Maroof AM et al. Directed differentiation and functional maturation of cortical interneurons from human embryonic stem cells. Cell Stem Cell 12:559-72 (2013). PubMed: 23642365
- García-Moreno F et al. A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei. Nat Neurosci 13:680-9 (2010). IHC-P ; Mouse . PubMed: 20495559
- Jakovcevski I et al. Multiple Origins of Human Neocortical Interneurons Are Supported by Distinct Expression of Transcription Factors. Cereb Cortex : (2010). IHC-Fr ; Human . PubMed: 21139075
- Gopal PP & Golden JA Pax6-/- mice have a cell nonautonomous defect in nonradial interneuron migration. Cereb Cortex 18:752-62 (2008). PubMed: 17634386