For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    lhx6-antibody-ab22885.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell differentiation
Share by email

Anti-LHX6 antibody (ab22885)

  • Datasheet
Reviews (3)Q&A (2)References (5)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-LHX6 antibody (ab22885)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LHX6 antibody (ab22885)

Key features and details

  • Rabbit polyclonal to LHX6
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Primary
Product image
Anti-Dlx5 antibody [EPR4488] (ab109737)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-LHX6 antibody
    See all LHX6 primary antibodies
  • Description

    Rabbit polyclonal to LHX6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide within Human LHX6 (C terminal). The exact sequence is proprietary.
    Sequence:

    LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Human 293T cell lysate. IHC-P: Human liver tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cell differentiation
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Developmental Families
    • LIM
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Transcription Factors
    • Neuroscience
    • Processes

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab22885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (1)
Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

IHC-P
Use a concentration of 4 - 8 µg/ml.
Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.

Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

IHC-P
Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession Q9UPM6 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 26468 Human
    • Entrez Gene: 16874 Mouse
    • Entrez Gene: 311901 Rat
    • Omim: 608215 Human
    • SwissProt: Q9UPM6 Human
    • SwissProt: O88706 Mouse
    • SwissProt: Q6P1H2 Mouse
    • SwissProt: Q9R1R0 Mouse
    • Unigene: 103137 Human
    • Unigene: 12881 Mouse
    see all
  • Alternative names

    • LHX 6 antibody
    • LHX 6.1 antibody
    • LHX6 antibody
    • LHX6.1 antibody
    • LHX6_HUMAN antibody
    • LIM homeobox 6 antibody
    • LIM homeobox protein 6 antibody
    • LIM homeodomain protein 6.1 antibody
    • LIM/homeobox protein Lhx6 antibody
    • LIM/homeobox protein Lhx6.1 antibody
    • MGC119542 antibody
    • MGC119544 antibody
    • MGC119545 antibody
    • OTTHUMP00000064113 antibody
    • OTTHUMP00000064114 antibody
    see all

Images

  • Western blot - Anti-LHX6 antibody (ab22885)
    Western blot - Anti-LHX6 antibody (ab22885)
    Anti-LHX6 antibody (ab22885) at 1 µg/ml + Human 293T cell lysate at 10 µg

    Predicted band size: 40 kDa



    Western blot analysis of human 293T cell lysate labeling LHX6 with ab22885. 

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LHX6 antibody (ab22885)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-LHX6 antibody (ab22885)
    Immunohistochemical analysis of LHX6 expression in paraffin embedded human liver tissue. ab22885 was used at 4 ug/ml. Arrows indicate positively labelled hepatocytes.

Protocols

  • Western blot protocols
  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (5)

Publishing research using ab22885? Please let us know so that we can cite the reference in this datasheet.

ab22885 has been referenced in 5 publications.

  • Xu R  et al. OLIG2 Drives Abnormal Neurodevelopmental Phenotypes in Human iPSC-Based Organoid and Chimeric Mouse Models of Down Syndrome. Cell Stem Cell 24:908-926.e8 (2019). PubMed: 31130512
  • Maroof AM  et al. Directed differentiation and functional maturation of cortical interneurons from human embryonic stem cells. Cell Stem Cell 12:559-72 (2013). PubMed: 23642365
  • García-Moreno F  et al. A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei. Nat Neurosci 13:680-9 (2010). IHC-P ; Mouse . PubMed: 20495559
  • Jakovcevski I  et al. Multiple Origins of Human Neocortical Interneurons Are Supported by Distinct Expression of Transcription Factors. Cereb Cortex : (2010). IHC-Fr ; Human . PubMed: 21139075
  • Gopal PP & Golden JA Pax6-/- mice have a cell nonautonomous defect in nonradial interneuron migration. Cereb Cortex 18:752-62 (2008). PubMed: 17634386

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Western blot abreview for Anti-LHX6 antibody

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Human Cell lysate - whole cell (human fibroblast and stem cells)
Loading amount
50 µg
Specification
human fibroblast and stem cells
Gel Running Conditions
Reduced Denaturing
Blocking step
Milk as blocking agent for 3 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 26°C
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Abcam user community

Verified customer

Submitted Sep 10 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.