Overview

  • Product name

  • Description

    Rabbit polyclonal to Lhx8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Lhx8 aa 307-356.
    Sequence:

    LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT


    Database link: Q68G74

  • Positive control

    • WB: RT4 cell lysate. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 39 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line)  cells stained for Lhx8 (green) using ab221882 at 4 µg/ml in ICC/IF.

  • Anti-Lhx8 antibody (ab221882) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 39 kDa

References

ab221882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up