Anti-LIF antibody (ab172023)
Key features and details
- Mouse polyclonal to LIF
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-LIF antibody
See all LIF primary antibodies -
Description
Mouse polyclonal to LIF -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human LIF aa 1-202. (NP_002300.1)
Sequence:MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRS QLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKA KLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSN VLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQ AF
Database link: P15018 -
Positive control
- Purchase matching WB positive control:Recombinant human LIF protein
- LIF transfected 293T lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172023 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa. |
Target
-
Function
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. -
Sequence similarities
Belongs to the LIF/OSM family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 3976 Human
- Omim: 159540 Human
- SwissProt: P15018 Human
- Unigene: 2250 Human
-
Alternative names
- CDF antibody
- Cholinergic Differentiation Factor antibody
- D factor antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172023 has not yet been referenced specifically in any publications.